Anti SERPING1 pAb (ATL-HPA048738)

Atlas Antibodies

Catalog No.: ATL-HPA048738-25

Protein Description: serpin peptidase inhibitor, clade G (C1 inhibitor), member 1
Gene Name: SERPING1
Alternative Gene Name: C1-INH, C1IN, C1NH, HAE1, HAE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023224: 77%, ENSRNOG00000007457: 79%
Entrez Gene ID: 710
Uniprot ID: P05155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVPQNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLNLCGLTED
• Gene Sequence: VPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVPQNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLNLCGLTED
• Gene ID - Mouse: ENSMUSG00000023224
• Gene ID - Rat: ENSRNOG00000007457
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERPING1 pAb (ATL-HPA048738) – 1 Found

Osther, Kurt; Förnvik, Karolina; Liljedahl, Emma; Salford, Leif G; Redebrandt, Henrietta Nittby. Upregulation of C1-inhibitor in pancreatic cancer. Oncotarget. 2019;10(55):5703-5712.