Anti SERPING1 pAb (ATL-HPA048738)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048738-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SERPING1
Alternative Gene Name: C1-INH, C1IN, C1NH, HAE1, HAE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023224: 77%, ENSRNOG00000007457: 79%
Entrez Gene ID: 710
Uniprot ID: P05155
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVPQNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLNLCGLTED |
| Gene Sequence | VPMMNSKKYPVAHFIDQTLKAKVGQLQLSHNLSLVILVPQNLKHRLEDMEQALSPSVFKAIMEKLEMSKFQPTLLTLPRIKVTTSQDMLSIMEKLEFFDFSYDLNLCGLTED |
| Gene ID - Mouse | ENSMUSG00000023224 |
| Gene ID - Rat | ENSRNOG00000007457 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SERPING1 pAb (ATL-HPA048738) | |
| Datasheet | Anti SERPING1 pAb (ATL-HPA048738) Datasheet (External Link) |
| Vendor Page | Anti SERPING1 pAb (ATL-HPA048738) at Atlas Antibodies |
| Documents & Links for Anti SERPING1 pAb (ATL-HPA048738) | |
| Datasheet | Anti SERPING1 pAb (ATL-HPA048738) Datasheet (External Link) |
| Vendor Page | Anti SERPING1 pAb (ATL-HPA048738) |
| Citations for Anti SERPING1 pAb (ATL-HPA048738) – 1 Found |
| Osther, Kurt; Förnvik, Karolina; Liljedahl, Emma; Salford, Leif G; Redebrandt, Henrietta Nittby. Upregulation of C1-inhibitor in pancreatic cancer. Oncotarget. 2019;10(55):5703-5712. PubMed |