Anti SERPINE3 pAb (ATL-HPA055804)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055804-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SERPINE3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091155: 46%, ENSRNOG00000009814: 49%
Entrez Gene ID: 647174
Uniprot ID: A8MV23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYP |
Gene Sequence | YVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYP |
Gene ID - Mouse | ENSMUSG00000091155 |
Gene ID - Rat | ENSRNOG00000009814 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SERPINE3 pAb (ATL-HPA055804) | |
Datasheet | Anti SERPINE3 pAb (ATL-HPA055804) Datasheet (External Link) |
Vendor Page | Anti SERPINE3 pAb (ATL-HPA055804) at Atlas Antibodies |
Documents & Links for Anti SERPINE3 pAb (ATL-HPA055804) | |
Datasheet | Anti SERPINE3 pAb (ATL-HPA055804) Datasheet (External Link) |
Vendor Page | Anti SERPINE3 pAb (ATL-HPA055804) |