Anti SERPINE3 pAb (ATL-HPA055804)

Atlas Antibodies

Catalog No.: ATL-HPA055804-25

Protein Description: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
Gene Name: SERPINE3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091155: 46%, ENSRNOG00000009814: 49%
Entrez Gene ID: 647174
Uniprot ID: A8MV23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYP
• Gene Sequence: YVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYP
• Gene ID - Mouse: ENSMUSG00000091155
• Gene ID - Rat: ENSRNOG00000009814
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.