Anti SERPINE3 pAb (ATL-HPA055804)

Atlas Antibodies

Catalog No.:
ATL-HPA055804-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 3
Gene Name: SERPINE3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091155: 46%, ENSRNOG00000009814: 49%
Entrez Gene ID: 647174
Uniprot ID: A8MV23
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYP
Gene Sequence YVSEAIHKAKIEVLEEGTKASGATALLLLKRSRIPIFKADRPFIYFLREPNTGITVFFDRIQIIYQCLSSNKGSFVHYP
Gene ID - Mouse ENSMUSG00000091155
Gene ID - Rat ENSRNOG00000009814
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERPINE3 pAb (ATL-HPA055804)
Datasheet Anti SERPINE3 pAb (ATL-HPA055804) Datasheet (External Link)
Vendor Page Anti SERPINE3 pAb (ATL-HPA055804) at Atlas Antibodies

Documents & Links for Anti SERPINE3 pAb (ATL-HPA055804)
Datasheet Anti SERPINE3 pAb (ATL-HPA055804) Datasheet (External Link)
Vendor Page Anti SERPINE3 pAb (ATL-HPA055804)