Anti SERPINE1 pAb (ATL-HPA050039)

Atlas Antibodies

SKU: ATL-HPA050039-25

• 
• 

Protein Description: serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1
Gene Name: SERPINE1
Alternative Gene Name: PAI, PAI1, PLANH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037411: 83%, ENSRNOG00000001414: 84%
Entrez Gene ID: 5054
Uniprot ID: P05121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADF
• Gene Sequence: RLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEVPLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADF
• Gene ID - Mouse: ENSMUSG00000037411
• Gene ID - Rat: ENSRNOG00000001414
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERPINE1 pAb (ATL-HPA050039) – 5 Found

Chan, Owen T M; Furuya, Hideki; Pagano, Ian; Shimizu, Yoshiko; Hokutan, Kanani; Dyrskjøt, Lars; Jensen, Jørgen Bjerggaard; Malmstrom, Per-Uno; Segersten, Ulrika; Janku, Filip; Rosser, Charles J. Association of MMP-2, RB and PAI-1 with decreased recurrence-free survival and overall survival in bladder cancer patients. Oncotarget. 2017;8(59):99707-99721. 

Zhang, Ge; Gomes-Giacoia, Evan; Dai, Yunfeng; Lawton, Adrienne; Miyake, Makito; Furuya, Hideki; Goodison, Steve; Rosser, Charles J. Validation and clinicopathologic associations of a urine-based bladder cancer biomarker signature. Diagnostic Pathology. 2014;9( 25387487):200. 

Furuya, Hideki; Chan, Owen T M; Hokutan, Kanani; Tsukikawa, Yutaro; Chee, Keanu; Kozai, Landon; Chan, Keith S; Dai, Yunfeng; Wong, Regan S; Rosser, Charles J. Prognostic Significance of Lymphocyte Infiltration and a Stromal Immunostaining of a Bladder Cancer Associated Diagnostic Panel in Urothelial Carcinoma. Diagnostics (Basel, Switzerland). 2019;10(1) 

Wang, Xiaowen; Bustos, Matias A; Zhang, Xiaoqing; Ramos, Romela Irene; Tan, Cong; Iida, Yuuki; Chang, Shu-Ching; Salomon, Matthew P; Tran, Kevin; Gentry, Rebecca; Kravtsova-Ivantsiv, Yelena; Kelly, Daniel F; Mills, Gordon B; Ciechanover, Aaron; Mao, Ying; Hoon, Dave S B. Downregulation of the Ubiquitin-E3 Ligase RNF123 Promotes Upregulation of the NF-κB1 Target SerpinE1 in Aggressive Glioblastoma Tumors. Cancers. 2020;12(5) 

Furuya, Hideki; Sasaki, Yuka; Chen, Runpu; Peres, Rafael; Hokutan, Kanani; Murakami, Kaoru; Kim, Nari; Chan, Owen T M; Pagano, Ian; Dyrskjøt, Lars; Jensen, Jørgen B; Malmstrom, Per-Uno; Segersten, Ulrika; Sun, Yijun; Arab, Abolfazl; Goodarzi, Hani; Goodison, Steve; Rosser, Charles J. PAI-1 is a potential transcriptional silencer that supports bladder cancer cell activity. Scientific Reports. 2022;12(1):12186.