Anti SERPIND1 pAb (ATL-HPA055767)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055767-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SERPIND1
Alternative Gene Name: D22S673, HC-II, HC2, HCF2, HLS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022766: 89%, ENSRNOG00000001865: 87%
Entrez Gene ID: 3053
Uniprot ID: P05546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE |
Gene Sequence | EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE |
Gene ID - Mouse | ENSMUSG00000022766 |
Gene ID - Rat | ENSRNOG00000001865 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SERPIND1 pAb (ATL-HPA055767) | |
Datasheet | Anti SERPIND1 pAb (ATL-HPA055767) Datasheet (External Link) |
Vendor Page | Anti SERPIND1 pAb (ATL-HPA055767) at Atlas Antibodies |
Documents & Links for Anti SERPIND1 pAb (ATL-HPA055767) | |
Datasheet | Anti SERPIND1 pAb (ATL-HPA055767) Datasheet (External Link) |
Vendor Page | Anti SERPIND1 pAb (ATL-HPA055767) |