Anti SERPIND1 pAb (ATL-HPA055767)

Atlas Antibodies

Catalog No.:
ATL-HPA055767-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: serpin peptidase inhibitor, clade D (heparin cofactor), member 1
Gene Name: SERPIND1
Alternative Gene Name: D22S673, HC-II, HC2, HCF2, HLS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022766: 89%, ENSRNOG00000001865: 87%
Entrez Gene ID: 3053
Uniprot ID: P05546
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE
Gene Sequence EAQIADFSDPAFISKTNNHIMKLTKGLIKDALENIDPATQMMILNCIYFKGSWVNKFPVEMTHNHNFRLNE
Gene ID - Mouse ENSMUSG00000022766
Gene ID - Rat ENSRNOG00000001865
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERPIND1 pAb (ATL-HPA055767)
Datasheet Anti SERPIND1 pAb (ATL-HPA055767) Datasheet (External Link)
Vendor Page Anti SERPIND1 pAb (ATL-HPA055767) at Atlas Antibodies

Documents & Links for Anti SERPIND1 pAb (ATL-HPA055767)
Datasheet Anti SERPIND1 pAb (ATL-HPA055767) Datasheet (External Link)
Vendor Page Anti SERPIND1 pAb (ATL-HPA055767)