Anti SERPINB5 pAb (ATL-HPA019025 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019025-25

Protein Description: serpin peptidase inhibitor, clade B (ovalbumin), member 5
Gene Name: SERPINB5
Alternative Gene Name: maspin, PI5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067006: 92%, ENSRNOG00000002640: 94%
Entrez Gene ID: 5268
Uniprot ID: P36952
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVD
• Gene Sequence: MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHFENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVD
• Gene ID - Mouse: ENSMUSG00000067006
• Gene ID - Rat: ENSRNOG00000002640
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERPINB5 pAb (ATL-HPA019025 w/enhanced validation) – 3 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Tanaka, Atsushi; Wang, Julia Y; Shia, Jinru; Zhou, Yihua; Ogawa, Makiko; Hendrickson, Ronald C; Klimstra, David S; Roehrl, Michael H A. Maspin as a Prognostic Marker for Early Stage Colorectal Cancer With Microsatellite Instability. Frontiers In Oncology. 10( 32587829):945. 

32602540. Correction: The roles of MASPIN expression and subcellular localization in non-small cell lung cancer. Bioscience Reports. 2020;40(7)