Anti SERPINB4 pAb (ATL-HPA048341)
Atlas Antibodies
- Catalog No.:
- ATL-HPA048341-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SERPINB4
Alternative Gene Name: LEUPIN, PI11, SCCA-2, SCCA1, SCCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058017: 61%, ENSRNOG00000002578: 61%
Entrez Gene ID: 6318
Uniprot ID: P48594
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QEYLDAIKKFYQTSVESTDFANAPEESRKKI |
Gene Sequence | QEYLDAIKKFYQTSVESTDFANAPEESRKKI |
Gene ID - Mouse | ENSMUSG00000058017 |
Gene ID - Rat | ENSRNOG00000002578 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SERPINB4 pAb (ATL-HPA048341) | |
Datasheet | Anti SERPINB4 pAb (ATL-HPA048341) Datasheet (External Link) |
Vendor Page | Anti SERPINB4 pAb (ATL-HPA048341) at Atlas Antibodies |
Documents & Links for Anti SERPINB4 pAb (ATL-HPA048341) | |
Datasheet | Anti SERPINB4 pAb (ATL-HPA048341) Datasheet (External Link) |
Vendor Page | Anti SERPINB4 pAb (ATL-HPA048341) |