Anti SERPINB3 pAb (ATL-HPA055992)

Atlas Antibodies

Catalog No.: ATL-HPA055992-25

Protein Description: serpin peptidase inhibitor, clade B (ovalbumin), member 3
Gene Name: SERPINB3
Alternative Gene Name: HsT1196, SCC, SCCA1, T4-A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044594: 58%, ENSRNOG00000002578: 54%
Entrez Gene ID: 6317
Uniprot ID: P29508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVLHFDQVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELK
• Gene Sequence: KVLHFDQVTENTTEKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELK
• Gene ID - Mouse: ENSMUSG00000044594
• Gene ID - Rat: ENSRNOG00000002578
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.