Anti SERPINB13 pAb (ATL-HPA057129 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA057129-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: serpin peptidase inhibitor, clade B (ovalbumin), member 13
Gene Name: SERPINB13
Alternative Gene Name: headpin, HUR7, hurpin, PI13
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048775: 66%, ENSRNOG00000028194: 60%
Entrez Gene ID: 5275
Uniprot ID: Q9UIV8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGHMEERKVNLHLPRFEVEDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTE
Gene Sequence PGHMEERKVNLHLPRFEVEDSYDLEAVLAAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTE
Gene ID - Mouse ENSMUSG00000048775
Gene ID - Rat ENSRNOG00000028194
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERPINB13 pAb (ATL-HPA057129 w/enhanced validation)
Datasheet Anti SERPINB13 pAb (ATL-HPA057129 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SERPINB13 pAb (ATL-HPA057129 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SERPINB13 pAb (ATL-HPA057129 w/enhanced validation)
Datasheet Anti SERPINB13 pAb (ATL-HPA057129 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SERPINB13 pAb (ATL-HPA057129 w/enhanced validation)
Citations for Anti SERPINB13 pAb (ATL-HPA057129 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed