Anti SERPINB10 pAb (ATL-HPA059582)

Atlas Antibodies

Catalog No.:
ATL-HPA059582-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: serpin peptidase inhibitor, clade B (ovalbumin), member 10
Gene Name: SERPINB10
Alternative Gene Name: bomapin, PI10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021403: 58%, ENSRNOG00000002417: 79%
Entrez Gene ID: 5273
Uniprot ID: P48595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen INSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKK
Gene Sequence INSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKK
Gene ID - Mouse ENSMUSG00000021403
Gene ID - Rat ENSRNOG00000002417
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERPINB10 pAb (ATL-HPA059582)
Datasheet Anti SERPINB10 pAb (ATL-HPA059582) Datasheet (External Link)
Vendor Page Anti SERPINB10 pAb (ATL-HPA059582) at Atlas Antibodies

Documents & Links for Anti SERPINB10 pAb (ATL-HPA059582)
Datasheet Anti SERPINB10 pAb (ATL-HPA059582) Datasheet (External Link)
Vendor Page Anti SERPINB10 pAb (ATL-HPA059582)