Anti SERPINB10 pAb (ATL-HPA059582)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059582-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SERPINB10
Alternative Gene Name: bomapin, PI10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021403: 58%, ENSRNOG00000002417: 79%
Entrez Gene ID: 5273
Uniprot ID: P48595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | INSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKK |
| Gene Sequence | INSWVERQTEGKIQNLLPDDSVDSTTRMILVNALYFKGIWEHQFLVQNTTEKPFRINETTSKPVQMMFMKK |
| Gene ID - Mouse | ENSMUSG00000021403 |
| Gene ID - Rat | ENSRNOG00000002417 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SERPINB10 pAb (ATL-HPA059582) | |
| Datasheet | Anti SERPINB10 pAb (ATL-HPA059582) Datasheet (External Link) |
| Vendor Page | Anti SERPINB10 pAb (ATL-HPA059582) at Atlas Antibodies |
| Documents & Links for Anti SERPINB10 pAb (ATL-HPA059582) | |
| Datasheet | Anti SERPINB10 pAb (ATL-HPA059582) Datasheet (External Link) |
| Vendor Page | Anti SERPINB10 pAb (ATL-HPA059582) |