Anti SERPINB1 pAb (ATL-HPA018871 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA018871-25

Protein Description: serpin peptidase inhibitor, clade B (ovalbumin), member 1
Gene Name: SERPINB1
Alternative Gene Name: anti-elastase, EI, ELANH2, PI2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044734: 79%, ENSRNOG00000016581: 78%
Entrez Gene ID: 1992
Uniprot ID: P30740
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFK
• Gene Sequence: GNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFK
• Gene ID - Mouse: ENSMUSG00000044734
• Gene ID - Rat: ENSRNOG00000016581
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SERPINB1 pAb (ATL-HPA018871 w/enhanced validation) – 4 Found

Gallardo, Miguel; Barrio, Santiago; Fernandez, Marisol; Paradela, Alberto; Arenas, Alicia; Toldos, Oscar; Ayala, Rosa; Albizua, Enriqueta; Jimenez, Ana; Redondo, Santiago; Garcia-Martin, Rosa Maria; Gilsanz, Florinda; Albar, Juan Pablo; Martinez-Lopez, Joaquin. Proteomic analysis reveals heat shock protein 70 has a key role in polycythemia Vera. Molecular Cancer. 2013;12( 24252366):142. 

Willmes, Christoph; Kumar, Rajiv; Becker, Jürgen C; Fried, Isabella; Rachakonda, P Sivaramakrishna; Poppe, Lidia M; Hesbacher, Sonja; Schadendorf, Dirk; Sucker, Antje; Schrama, David; Ugurel, Selma. SERPINB1 expression is predictive for sensitivity and outcome of cisplatin-based chemotherapy in melanoma. Oncotarget. 2016;7(9):10117-32. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Bradley, Frideborg; Franzén Boger, Mathias; Kaldhusdal, Vilde; Åhlberg, Alexandra; Edfeldt, Gabriella; Lajoie, Julie; Bergström, Sofia; Omollo, Kenneth; Damdimopoulos, Anastasios; Czarnewski, Paulo; Månberg, Anna; Oyugi, Julius; Kimani, Joshua; Nilsson, Peter; Fowke, Keith; Tjernlund, Annelie; Broliden, Kristina. Multi-omics analysis of the cervical epithelial integrity of women using depot medroxyprogesterone acetate. Plos Pathogens. 2022;18(5):e1010494.