Anti SERPINA5 pAb (ATL-HPA078846 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA078846-25
  • Immunohistochemistry analysis in human testis and cerebral cortex tissues using Anti-SERPINA5 antibody. Corresponding SERPINA5 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: serpin family A member 5
Gene Name: SERPINA5
Alternative Gene Name: PAI3, PCI, PLANH3, PROCI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041550: 56%, ENSRNOG00000009855: 53%
Entrez Gene ID: 5104
Uniprot ID: P05154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT
Gene Sequence KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT
Gene ID - Mouse ENSMUSG00000041550
Gene ID - Rat ENSRNOG00000009855
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti SERPINA5 pAb (ATL-HPA078846 w/enhanced validation)
Datasheet Anti SERPINA5 pAb (ATL-HPA078846 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SERPINA5 pAb (ATL-HPA078846 w/enhanced validation)