Anti SERF1A pAb (ATL-HPA075271)

Atlas Antibodies

SKU: ATL-HPA075271-25

• 

Protein Description: small EDRK-rich factor 1A (telomeric)
Gene Name: SERF1A
Alternative Gene Name: 4F5, FAM2A, H4F5, SERF1, SMAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051768: 38%, ENSRNOG00000051204: 38%
Entrez Gene ID: 8293
Uniprot ID: O75920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR
• Gene Sequence: SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR
• Gene ID - Mouse: ENSMUSG00000051768
• Gene ID - Rat: ENSRNOG00000051204
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.