Anti SERF1A pAb (ATL-HPA075271)

Atlas Antibodies

Catalog No.:
ATL-HPA075271-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: small EDRK-rich factor 1A (telomeric)
Gene Name: SERF1A
Alternative Gene Name: 4F5, FAM2A, H4F5, SERF1, SMAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051768: 38%, ENSRNOG00000051204: 38%
Entrez Gene ID: 8293
Uniprot ID: O75920
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR
Gene Sequence SSGGQKSESKMSAGPHLPLKAPRENPCFPLPAAGGSR
Gene ID - Mouse ENSMUSG00000051768
Gene ID - Rat ENSRNOG00000051204
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SERF1A pAb (ATL-HPA075271)
Datasheet Anti SERF1A pAb (ATL-HPA075271) Datasheet (External Link)
Vendor Page Anti SERF1A pAb (ATL-HPA075271) at Atlas Antibodies

Documents & Links for Anti SERF1A pAb (ATL-HPA075271)
Datasheet Anti SERF1A pAb (ATL-HPA075271) Datasheet (External Link)
Vendor Page Anti SERF1A pAb (ATL-HPA075271)