Anti SEPT5 pAb (ATL-HPA063885 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA063885-25

• 

Protein Description: septin 5
Gene Name: SEPT5
Alternative Gene Name: H5, HCDCREL-1, PNUTL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072214: 97%, ENSRNOG00000029912: 97%
Entrez Gene ID: 5413
Uniprot ID: Q99719
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPE
• Gene Sequence: VPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPE
• Gene ID - Mouse: ENSMUSG00000072214
• Gene ID - Rat: ENSRNOG00000029912
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.