Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA073635-25
  • Immunohistochemistry analysis in human spleen and skeletal muscle tissues using Anti-SEPT1 antibody. Corresponding SEPT1 RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: septin 1
Gene Name: SEPT1
Alternative Gene Name: DIFF6, PNUTL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000486: 94%, ENSRNOG00000017804: 88%
Entrez Gene ID: 1731
Uniprot ID: Q8WYJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVIGKADALMPQETQALKQKIRDQLKEEEIHIY
Gene Sequence PVIGKADALMPQETQALKQKIRDQLKEEEIHIY
Gene ID - Mouse ENSMUSG00000000486
Gene ID - Rat ENSRNOG00000017804
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation)
Datasheet Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation)
Datasheet Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti SEPT1 pAb (ATL-HPA073635 w/enhanced validation)