Anti SEPSECS pAb (ATL-HPA070409)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070409-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SEPSECS
Alternative Gene Name: SLA, SLA/LP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029173: 96%, ENSRNOG00000049244: 96%
Entrez Gene ID: 51091
Uniprot ID: Q9HD40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA |
| Gene Sequence | EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA |
| Gene ID - Mouse | ENSMUSG00000029173 |
| Gene ID - Rat | ENSRNOG00000049244 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SEPSECS pAb (ATL-HPA070409) | |
| Datasheet | Anti SEPSECS pAb (ATL-HPA070409) Datasheet (External Link) |
| Vendor Page | Anti SEPSECS pAb (ATL-HPA070409) at Atlas Antibodies |
| Documents & Links for Anti SEPSECS pAb (ATL-HPA070409) | |
| Datasheet | Anti SEPSECS pAb (ATL-HPA070409) Datasheet (External Link) |
| Vendor Page | Anti SEPSECS pAb (ATL-HPA070409) |