Anti SEPSECS pAb (ATL-HPA070409)

Atlas Antibodies

Catalog No.: ATL-HPA070409-25

Protein Description: Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase
Gene Name: SEPSECS
Alternative Gene Name: SLA, SLA/LP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029173: 96%, ENSRNOG00000049244: 96%
Entrez Gene ID: 51091
Uniprot ID: Q9HD40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA
• Gene Sequence: EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA
• Gene ID - Mouse: ENSMUSG00000029173
• Gene ID - Rat: ENSRNOG00000049244
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.