Anti SEPSECS pAb (ATL-HPA070409)

Atlas Antibodies

Catalog No.:
ATL-HPA070409-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Sep (O-phosphoserine) tRNA:Sec (selenocysteine) tRNA synthase
Gene Name: SEPSECS
Alternative Gene Name: SLA, SLA/LP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029173: 96%, ENSRNOG00000049244: 96%
Entrez Gene ID: 51091
Uniprot ID: Q9HD40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA
Gene Sequence EKGKCPENGWDESTLELFLHELAIMDSNNFLGNCGVGEREGRVASALVARRHYRFIHGIGRSGDISAVQPKA
Gene ID - Mouse ENSMUSG00000029173
Gene ID - Rat ENSRNOG00000049244
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEPSECS pAb (ATL-HPA070409)
Datasheet Anti SEPSECS pAb (ATL-HPA070409) Datasheet (External Link)
Vendor Page Anti SEPSECS pAb (ATL-HPA070409) at Atlas Antibodies

Documents & Links for Anti SEPSECS pAb (ATL-HPA070409)
Datasheet Anti SEPSECS pAb (ATL-HPA070409) Datasheet (External Link)
Vendor Page Anti SEPSECS pAb (ATL-HPA070409)