Anti SEPHS2 pAb (ATL-HPA047931)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047931-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SEPHS2
Alternative Gene Name: SPS2, SPS2b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049091: 62%, ENSRNOG00000021012: 36%
Entrez Gene ID: 22928
Uniprot ID: Q99611
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI |
Gene Sequence | KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI |
Gene ID - Mouse | ENSMUSG00000049091 |
Gene ID - Rat | ENSRNOG00000021012 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SEPHS2 pAb (ATL-HPA047931) | |
Datasheet | Anti SEPHS2 pAb (ATL-HPA047931) Datasheet (External Link) |
Vendor Page | Anti SEPHS2 pAb (ATL-HPA047931) at Atlas Antibodies |
Documents & Links for Anti SEPHS2 pAb (ATL-HPA047931) | |
Datasheet | Anti SEPHS2 pAb (ATL-HPA047931) Datasheet (External Link) |
Vendor Page | Anti SEPHS2 pAb (ATL-HPA047931) |