Anti SEPHS2 pAb (ATL-HPA047931)

Atlas Antibodies

Catalog No.:
ATL-HPA047931-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: selenophosphate synthetase 2
Gene Name: SEPHS2
Alternative Gene Name: SPS2, SPS2b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049091: 62%, ENSRNOG00000021012: 36%
Entrez Gene ID: 22928
Uniprot ID: Q99611
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI
Gene Sequence KLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGI
Gene ID - Mouse ENSMUSG00000049091
Gene ID - Rat ENSRNOG00000021012
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEPHS2 pAb (ATL-HPA047931)
Datasheet Anti SEPHS2 pAb (ATL-HPA047931) Datasheet (External Link)
Vendor Page Anti SEPHS2 pAb (ATL-HPA047931) at Atlas Antibodies

Documents & Links for Anti SEPHS2 pAb (ATL-HPA047931)
Datasheet Anti SEPHS2 pAb (ATL-HPA047931) Datasheet (External Link)
Vendor Page Anti SEPHS2 pAb (ATL-HPA047931)