Anti SENP7 pAb (ATL-HPA071998)

Atlas Antibodies

Catalog No.:
ATL-HPA071998-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: SUMO1/sentrin specific peptidase 7
Gene Name: SENP7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052917: 41%, ENSRNOG00000001616: 37%
Entrez Gene ID: 57337
Uniprot ID: Q9BQF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISLLISDTQPEDLNSGSRGCDHLEQESRNKDVKYSDSKVELTLISRKTKRRLRNNLPDSQYCTSLD
Gene Sequence SERGSQRSKTVDDNSAKQTAHNKEKRRKDDGISLLISDTQPEDLNSGSRGCDHLEQESRNKDVKYSDSKVELTLISRKTKRRLRNNLPDSQYCTSLD
Gene ID - Mouse ENSMUSG00000052917
Gene ID - Rat ENSRNOG00000001616
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SENP7 pAb (ATL-HPA071998)
Datasheet Anti SENP7 pAb (ATL-HPA071998) Datasheet (External Link)
Vendor Page Anti SENP7 pAb (ATL-HPA071998) at Atlas Antibodies

Documents & Links for Anti SENP7 pAb (ATL-HPA071998)
Datasheet Anti SENP7 pAb (ATL-HPA071998) Datasheet (External Link)
Vendor Page Anti SENP7 pAb (ATL-HPA071998)