Anti SENP3 pAb (ATL-HPA060290)

Atlas Antibodies

Catalog No.:
ATL-HPA060290-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: SUMO1/sentrin/SMT3 specific peptidase 3
Gene Name: SENP3
Alternative Gene Name: DKFZP586K0919, DKFZp762A152, SMT3IP1, SSP3, Ulp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005204: 98%, ENSRNOG00000013746: 98%
Entrez Gene ID: 26168
Uniprot ID: Q9H4L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL
Gene Sequence LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL
Gene ID - Mouse ENSMUSG00000005204
Gene ID - Rat ENSRNOG00000013746
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SENP3 pAb (ATL-HPA060290)
Datasheet Anti SENP3 pAb (ATL-HPA060290) Datasheet (External Link)
Vendor Page Anti SENP3 pAb (ATL-HPA060290) at Atlas Antibodies

Documents & Links for Anti SENP3 pAb (ATL-HPA060290)
Datasheet Anti SENP3 pAb (ATL-HPA060290) Datasheet (External Link)
Vendor Page Anti SENP3 pAb (ATL-HPA060290)