Anti SENP3 pAb (ATL-HPA060290)
Atlas Antibodies
- Catalog No.:
- ATL-HPA060290-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SENP3
Alternative Gene Name: DKFZP586K0919, DKFZp762A152, SMT3IP1, SSP3, Ulp1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005204: 98%, ENSRNOG00000013746: 98%
Entrez Gene ID: 26168
Uniprot ID: Q9H4L4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL |
Gene Sequence | LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL |
Gene ID - Mouse | ENSMUSG00000005204 |
Gene ID - Rat | ENSRNOG00000013746 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SENP3 pAb (ATL-HPA060290) | |
Datasheet | Anti SENP3 pAb (ATL-HPA060290) Datasheet (External Link) |
Vendor Page | Anti SENP3 pAb (ATL-HPA060290) at Atlas Antibodies |
Documents & Links for Anti SENP3 pAb (ATL-HPA060290) | |
Datasheet | Anti SENP3 pAb (ATL-HPA060290) Datasheet (External Link) |
Vendor Page | Anti SENP3 pAb (ATL-HPA060290) |