Anti SEMG2 pAb (ATL-HPA042835 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042835-25

Protein Description: semenogelin II
Gene Name: SEMG2
Alternative Gene Name: SGII
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027288: 31%, ENSRNOG00000056703: 33%
Entrez Gene ID: 6407
Uniprot ID: Q02383
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNP
• Gene Sequence: GRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNP
• Gene ID - Mouse: ENSMUSG00000027288
• Gene ID - Rat: ENSRNOG00000056703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEMG2 pAb (ATL-HPA042835 w/enhanced validation) – 2 Found

Utsumi, Toshihiko; Matsuzaki, Kanako; Kiwado, Aya; Tanikawa, Ayane; Kikkawa, Yuki; Hosokawa, Takuro; Otsuka, Aoi; Iuchi, Yoshihito; Kobuchi, Hirotsugu; Moriya, Koko. Identification and characterization of protein N-myristoylation occurring on four human mitochondrial proteins, SAMM50, TOMM40, MIC19, and MIC25. Plos One. 13(11):e0206355. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.