Anti SEMA6B pAb (ATL-HPA058523)

Atlas Antibodies

Catalog No.: ATL-HPA058523-25

Protein Description: sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B
Gene Name: SEMA6B
Alternative Gene Name: SEM-SEMA-Y, SEMA-VIB, SEMAN, semaZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001227: 94%, ENSRNOG00000045998: 95%
Entrez Gene ID: 10501
Uniprot ID: Q9H3T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYLNHYPVFVGSGPGRLTPAEGADDLNIQRVLRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGECRNFVKVLL
• Gene Sequence: DYLNHYPVFVGSGPGRLTPAEGADDLNIQRVLRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGECRNFVKVLL
• Gene ID - Mouse: ENSMUSG00000001227
• Gene ID - Rat: ENSRNOG00000045998
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.