Anti SEMA6B pAb (ATL-HPA058523)
Atlas Antibodies
- SKU:
- ATL-HPA058523-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: SEMA6B
Alternative Gene Name: SEM-SEMA-Y, SEMA-VIB, SEMAN, semaZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001227: 94%, ENSRNOG00000045998: 95%
Entrez Gene ID: 10501
Uniprot ID: Q9H3T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DYLNHYPVFVGSGPGRLTPAEGADDLNIQRVLRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGECRNFVKVLL |
Gene Sequence | DYLNHYPVFVGSGPGRLTPAEGADDLNIQRVLRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGECRNFVKVLL |
Gene ID - Mouse | ENSMUSG00000001227 |
Gene ID - Rat | ENSRNOG00000045998 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SEMA6B pAb (ATL-HPA058523) | |
Datasheet | Anti SEMA6B pAb (ATL-HPA058523) Datasheet (External Link) |
Vendor Page | Anti SEMA6B pAb (ATL-HPA058523) at Atlas Antibodies |
Documents & Links for Anti SEMA6B pAb (ATL-HPA058523) | |
Datasheet | Anti SEMA6B pAb (ATL-HPA058523) Datasheet (External Link) |
Vendor Page | Anti SEMA6B pAb (ATL-HPA058523) |