Anti SEMA6B pAb (ATL-HPA058523)

Atlas Antibodies

Catalog No.:
ATL-HPA058523-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6B
Gene Name: SEMA6B
Alternative Gene Name: SEM-SEMA-Y, SEMA-VIB, SEMAN, semaZ
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001227: 94%, ENSRNOG00000045998: 95%
Entrez Gene ID: 10501
Uniprot ID: Q9H3T3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYLNHYPVFVGSGPGRLTPAEGADDLNIQRVLRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGECRNFVKVLL
Gene Sequence DYLNHYPVFVGSGPGRLTPAEGADDLNIQRVLRVNRTLFIGDRDNLYRVELEPPTSTELRYQRKLTWRSNPSDINVCRMKGKQEGECRNFVKVLL
Gene ID - Mouse ENSMUSG00000001227
Gene ID - Rat ENSRNOG00000045998
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEMA6B pAb (ATL-HPA058523)
Datasheet Anti SEMA6B pAb (ATL-HPA058523) Datasheet (External Link)
Vendor Page Anti SEMA6B pAb (ATL-HPA058523) at Atlas Antibodies

Documents & Links for Anti SEMA6B pAb (ATL-HPA058523)
Datasheet Anti SEMA6B pAb (ATL-HPA058523) Datasheet (External Link)
Vendor Page Anti SEMA6B pAb (ATL-HPA058523)