Anti SEMA5A pAb (ATL-HPA004632)

Atlas Antibodies

Catalog No.: ATL-HPA004632-25

Protein Description: sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5A
Gene Name: SEMA5A
Alternative Gene Name: SEMAF, semF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022231: 94%, ENSRNOG00000011977: 91%
Entrez Gene ID: 9037
Uniprot ID: Q13591
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGE
• Gene Sequence: PWTKCSATCGGGHYMRTRSCSNPAPAYGGDICLGLHTEEALCNTQPCPESWSEWSDWSECEASGVQVRARQCILLFPMGSQCSGNTTESRPCVFDSNFIPEVSVARSSSVEEKRCGE
• Gene ID - Mouse: ENSMUSG00000022231
• Gene ID - Rat: ENSRNOG00000011977
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.