Anti SEMA3E pAb (ATL-HPA063804)

Atlas Antibodies

SKU:
ATL-HPA063804-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$447.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.
Adding to cart… The item has been added
Protein Description: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3E
Gene Name: SEMA3E
Alternative Gene Name: coll-5, KIAA0331, M-SemaK, SEMAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000063531: 93%, ENSRNOG00000006631: 92%
Entrez Gene ID: 9723
Uniprot ID: O15041
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLLECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVK
Gene Sequence RHGNAAQQCFGQQFVGDALDKTEEHLAYGIENNSTLLECTPRSLQAKVIWFVQKGRETRKEEVKTDDRVVK
Gene ID - Mouse ENSMUSG00000063531
Gene ID - Rat ENSRNOG00000006631
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SEMA3E pAb (ATL-HPA063804)
Datasheet Anti SEMA3E pAb (ATL-HPA063804) Datasheet (External Link)
Vendor Page Anti SEMA3E pAb (ATL-HPA063804) at Atlas Antibodies

Documents & Links for Anti SEMA3E pAb (ATL-HPA063804)
Datasheet Anti SEMA3E pAb (ATL-HPA063804) Datasheet (External Link)
Vendor Page Anti SEMA3E pAb (ATL-HPA063804)