Anti SEMA3A pAb (ATL-HPA052235)

Atlas Antibodies

SKU: ATL-HPA052235-25

• 

Protein Description: sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3A
Gene Name: SEMA3A
Alternative Gene Name: coll-1, Hsema-I, SEMA1, SEMAD, SemD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028883: 93%, ENSRNOG00000023337: 94%
Entrez Gene ID: 10371
Uniprot ID: Q14563
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHL
• Gene Sequence: HGFIQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPSQKVWYRDFMQLINHPNLNTMDEFCEQVWKRDRKQRRQRPGHTPGNSNKWKHL
• Gene ID - Mouse: ENSMUSG00000028883
• Gene ID - Rat: ENSRNOG00000023337
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.