Anti SELENON pAb (ATL-HPA058076)

Atlas Antibodies

SKU:
ATL-HPA058076-25
  • Immunohistochemical staining of human lung shows strong cytoplasmic positivity in pneumocytes and macrophages.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: selenoprotein N
Gene Name: SELENON
Alternative Gene Name: MDRS1, RSMD1, RSS, SELN, SEPN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050989: 83%, ENSRNOG00000017078: 80%
Entrez Gene ID: 57190
Uniprot ID: Q9NZV5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WSLVKELEELQNKQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINANYFLDITSVKPEEIESNLFSFSSTFEDPST
Gene Sequence WSLVKELEELQNKQENSSHQKLAGLHLEKYSFPVEMMICLPNGTVVHHINANYFLDITSVKPEEIESNLFSFSSTFEDPST
Gene ID - Mouse ENSMUSG00000050989
Gene ID - Rat ENSRNOG00000017078
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SELENON pAb (ATL-HPA058076)
Datasheet Anti SELENON pAb (ATL-HPA058076) Datasheet (External Link)
Vendor Page Anti SELENON pAb (ATL-HPA058076) at Atlas Antibodies

Documents & Links for Anti SELENON pAb (ATL-HPA058076)
Datasheet Anti SELENON pAb (ATL-HPA058076) Datasheet (External Link)
Vendor Page Anti SELENON pAb (ATL-HPA058076)