Anti SEL1L3 pAb (ATL-HPA058792)

Atlas Antibodies

SKU:
ATL-HPA058792-25
  • Immunohistochemical staining of human duodenum shows cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sel-1 suppressor of lin-12-like 3 (C. elegans)
Gene Name: SEL1L3
Alternative Gene Name: KIAA0746
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029189: 70%, ENSRNOG00000004932: 67%
Entrez Gene ID: 23231
Uniprot ID: Q68CR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ERCAEVQEIVSVYASAAKHGGERQEACHLHNSYLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSEIGGKIFEKAVKRLSSIDGL
Gene Sequence ERCAEVQEIVSVYASAAKHGGERQEACHLHNSYLDLQRRYGRPSMCRAFPWEKELKDKHPSLFQALLEMDLLTVPRNQNESVSEIGGKIFEKAVKRLSSIDGL
Gene ID - Mouse ENSMUSG00000029189
Gene ID - Rat ENSRNOG00000004932
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SEL1L3 pAb (ATL-HPA058792)
Datasheet Anti SEL1L3 pAb (ATL-HPA058792) Datasheet (External Link)
Vendor Page Anti SEL1L3 pAb (ATL-HPA058792) at Atlas Antibodies

Documents & Links for Anti SEL1L3 pAb (ATL-HPA058792)
Datasheet Anti SEL1L3 pAb (ATL-HPA058792) Datasheet (External Link)
Vendor Page Anti SEL1L3 pAb (ATL-HPA058792)