Anti SECTM1 pAb (ATL-HPA051214)

Atlas Antibodies

Catalog No.:
ATL-HPA051214-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: secreted and transmembrane 1
Gene Name: SECTM1
Alternative Gene Name: K12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055322: 31%, ENSRNOG00000043378: 29%
Entrez Gene ID: 6398
Uniprot ID: Q8WVN6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAAD
Gene Sequence CRCSQQRREKKFFLLEPQMKVAALRAGAQQGLSRASAELWTPDSEPTPRPLALVFKPSPLGALELLSPQPLFPYAAD
Gene ID - Mouse ENSMUSG00000055322
Gene ID - Rat ENSRNOG00000043378
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SECTM1 pAb (ATL-HPA051214)
Datasheet Anti SECTM1 pAb (ATL-HPA051214) Datasheet (External Link)
Vendor Page Anti SECTM1 pAb (ATL-HPA051214) at Atlas Antibodies

Documents & Links for Anti SECTM1 pAb (ATL-HPA051214)
Datasheet Anti SECTM1 pAb (ATL-HPA051214) Datasheet (External Link)
Vendor Page Anti SECTM1 pAb (ATL-HPA051214)