Anti SEC62 pAb (ATL-HPA014059)

Atlas Antibodies

Catalog No.: ATL-HPA014059-25

Protein Description: SEC62 homolog (S. cerevisiae)
Gene Name: SEC62
Alternative Gene Name: Dtrp1, HTP1, TLOC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027706: 91%, ENSRNOG00000009057: 90%
Entrez Gene ID: 7095
Uniprot ID: Q99442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
• Gene Sequence: GGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADLKKDEKSETKKQQKSDSEEKSDSEKKEDEEGKVGPGNHGTEGSGGERHSDTDSDRREDDRSQHSSGNGNDFEMITKEELEQQTDGDCEEDEEEENDGETPKSS
• Gene ID - Mouse: ENSMUSG00000027706
• Gene ID - Rat: ENSRNOG00000009057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEC62 pAb (ATL-HPA014059) – 4 Found

Hagerstrand, Daniel; Tong, Alexander; Schumacher, Steven E; Ilic, Nina; Shen, Rhine R; Cheung, Hiu Wing; Vazquez, Francisca; Shrestha, Yashaswi; Kim, So Young; Giacomelli, Andrew O; Rosenbluh, Joseph; Schinzel, Anna C; Spardy, Nicole A; Barbie, David A; Mermel, Craig H; Weir, Barbara A; Garraway, Levi A; Tamayo, Pablo; Mesirov, Jill P; Beroukhim, Rameen; Hahn, William C. Systematic interrogation of 3q26 identifies TLOC1 and SKIL as cancer drivers. Cancer Discovery. 2013;3(9):1044-57. 

Jadhav, Bhalchandra; McKenna, Michael; Johnson, Nicholas; High, Stephen; Sinning, Irmgard; Pool, Martin R. Mammalian SRP receptor switches the Sec61 translocase from Sec62 to SRP-dependent translocation. Nature Communications. 2015;6( 26634806):10133. 

Hirata, Tetsuya; Yang, Jing; Tomida, Seita; Tokoro, Yuko; Kinoshita, Taroh; Fujita, Morihisa; Kizuka, Yasuhiko. ER entry pathway and glycosylation of GPI-anchored proteins are determined by N-terminal signal sequence and C-terminal GPI-attachment sequence. The Journal Of Biological Chemistry. 2022;298(10):102444. 

Herrera-Cruz, Maria Sol; Yap, Megan C; Tahbaz, Nasser; Phillips, Keelie; Thomas, Laurel; Thomas, Gary; Simmen, Thomas. Rab32 uses its effector reticulon 3L to trigger autophagic degradation of mitochondria-associated membrane (MAM) proteins. Biology Direct. 2021;16(1):22.