Anti SEC61B pAb (ATL-HPA049407)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049407-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SEC61B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053317: 100%, ENSRNOG00000006345: 100%
Entrez Gene ID: 10952
Uniprot ID: P60468
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK |
Gene Sequence | AAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLK |
Gene ID - Mouse | ENSMUSG00000053317 |
Gene ID - Rat | ENSRNOG00000006345 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SEC61B pAb (ATL-HPA049407) | |
Datasheet | Anti SEC61B pAb (ATL-HPA049407) Datasheet (External Link) |
Vendor Page | Anti SEC61B pAb (ATL-HPA049407) at Atlas Antibodies |
Documents & Links for Anti SEC61B pAb (ATL-HPA049407) | |
Datasheet | Anti SEC61B pAb (ATL-HPA049407) Datasheet (External Link) |
Vendor Page | Anti SEC61B pAb (ATL-HPA049407) |