Anti SEC24D pAb (ATL-HPA053486)

Atlas Antibodies

Catalog No.:
ATL-HPA053486-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: SEC24 homolog D, COPII coat complex component
Gene Name: SEC24D
Alternative Gene Name: KIAA0755
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039234: 85%, ENSRNOG00000014872: 84%
Entrez Gene ID: 9871
Uniprot ID: O94855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQP
Gene Sequence IFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQP
Gene ID - Mouse ENSMUSG00000039234
Gene ID - Rat ENSRNOG00000014872
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SEC24D pAb (ATL-HPA053486)
Datasheet Anti SEC24D pAb (ATL-HPA053486) Datasheet (External Link)
Vendor Page Anti SEC24D pAb (ATL-HPA053486) at Atlas Antibodies

Documents & Links for Anti SEC24D pAb (ATL-HPA053486)
Datasheet Anti SEC24D pAb (ATL-HPA053486) Datasheet (External Link)
Vendor Page Anti SEC24D pAb (ATL-HPA053486)