Anti SEC24D pAb (ATL-HPA053486)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053486-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SEC24D
Alternative Gene Name: KIAA0755
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039234: 85%, ENSRNOG00000014872: 84%
Entrez Gene ID: 9871
Uniprot ID: O94855
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQP |
Gene Sequence | IFLLANGLHMFLWLGVSSPPELIQGIFNVPSFAHINTDMTLLPEVGNPYSQQLRMIMGIIQQKRPYSMKLTIVKQREQP |
Gene ID - Mouse | ENSMUSG00000039234 |
Gene ID - Rat | ENSRNOG00000014872 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SEC24D pAb (ATL-HPA053486) | |
Datasheet | Anti SEC24D pAb (ATL-HPA053486) Datasheet (External Link) |
Vendor Page | Anti SEC24D pAb (ATL-HPA053486) at Atlas Antibodies |
Documents & Links for Anti SEC24D pAb (ATL-HPA053486) | |
Datasheet | Anti SEC24D pAb (ATL-HPA053486) Datasheet (External Link) |
Vendor Page | Anti SEC24D pAb (ATL-HPA053486) |