Anti SEC24A pAb (ATL-HPA056825)

Atlas Antibodies

SKU: ATL-HPA056825-25

• 

Protein Description: SEC24 homolog A, COPII coat complex component
Gene Name: SEC24A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036391: 77%, ENSRNOG00000004563: 78%
Entrez Gene ID: 10802
Uniprot ID: O95486
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NGPVQNALLSSQESVSQGYNFQLPGSYPHPIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTPMP
• Gene Sequence: NGPVQNALLSSQESVSQGYNFQLPGSYPHPIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTPMP
• Gene ID - Mouse: ENSMUSG00000036391
• Gene ID - Rat: ENSRNOG00000004563
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SEC24A pAb (ATL-HPA056825) – 1 Found

Zeyen, Lisa; Döring, Tatjana; Prange, Reinhild. Hepatitis B Virus Exploits ERGIC-53 in Conjunction with COPII to Exit Cells. Cells. 2020;9(8)