Anti SEC24A pAb (ATL-HPA056825)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056825-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SEC24A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036391: 77%, ENSRNOG00000004563: 78%
Entrez Gene ID: 10802
Uniprot ID: O95486
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NGPVQNALLSSQESVSQGYNFQLPGSYPHPIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTPMP |
| Gene Sequence | NGPVQNALLSSQESVSQGYNFQLPGSYPHPIPAKTLNPVSGQSNYGGSQGSGQTLNRPPVASNPVTPSLHSGPAPRMPLPASQNPATTPMP |
| Gene ID - Mouse | ENSMUSG00000036391 |
| Gene ID - Rat | ENSRNOG00000004563 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SEC24A pAb (ATL-HPA056825) | |
| Datasheet | Anti SEC24A pAb (ATL-HPA056825) Datasheet (External Link) |
| Vendor Page | Anti SEC24A pAb (ATL-HPA056825) at Atlas Antibodies |
| Documents & Links for Anti SEC24A pAb (ATL-HPA056825) | |
| Datasheet | Anti SEC24A pAb (ATL-HPA056825) Datasheet (External Link) |
| Vendor Page | Anti SEC24A pAb (ATL-HPA056825) |
| Citations for Anti SEC24A pAb (ATL-HPA056825) – 1 Found |
| Zeyen, Lisa; Döring, Tatjana; Prange, Reinhild. Hepatitis B Virus Exploits ERGIC-53 in Conjunction with COPII to Exit Cells. Cells. 2020;9(8) PubMed |