Anti SEC23B pAb (ATL-HPA069974)

Atlas Antibodies

SKU:
ATL-HPA069974-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity with a granular pattern in glandular cells.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Sec23 homolog B, COPII coat complex component
Gene Name: SEC23B
Alternative Gene Name: CDA-II, CDAII, CDAN2, HEMPAS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020986: 96%, ENSRNOG00000004657: 96%
Entrez Gene ID: 10483
Uniprot ID: Q15437
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IDIYACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKD
Gene Sequence IDIYACALDQTGLLEMKCCANLTGGYMVMGDSFNTSLFKQTFQRIFTKD
Gene ID - Mouse ENSMUSG00000020986
Gene ID - Rat ENSRNOG00000004657
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SEC23B pAb (ATL-HPA069974)
Datasheet Anti SEC23B pAb (ATL-HPA069974) Datasheet (External Link)
Vendor Page Anti SEC23B pAb (ATL-HPA069974) at Atlas Antibodies

Documents & Links for Anti SEC23B pAb (ATL-HPA069974)
Datasheet Anti SEC23B pAb (ATL-HPA069974) Datasheet (External Link)
Vendor Page Anti SEC23B pAb (ATL-HPA069974)