Anti SEC13 pAb (ATL-HPA057943)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057943-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SEC13
Alternative Gene Name: D3S1231E, npp-20, SEC13L1, SEC13R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030298: 97%, ENSRNOG00000010628: 97%
Entrez Gene ID: 6396
Uniprot ID: P55735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD |
Gene Sequence | IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD |
Gene ID - Mouse | ENSMUSG00000030298 |
Gene ID - Rat | ENSRNOG00000010628 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SEC13 pAb (ATL-HPA057943) | |
Datasheet | Anti SEC13 pAb (ATL-HPA057943) Datasheet (External Link) |
Vendor Page | Anti SEC13 pAb (ATL-HPA057943) at Atlas Antibodies |
Documents & Links for Anti SEC13 pAb (ATL-HPA057943) | |
Datasheet | Anti SEC13 pAb (ATL-HPA057943) Datasheet (External Link) |
Vendor Page | Anti SEC13 pAb (ATL-HPA057943) |