Anti SEC13 pAb (ATL-HPA057943)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057943-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SEC13
Alternative Gene Name: D3S1231E, npp-20, SEC13L1, SEC13R
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030298: 97%, ENSRNOG00000010628: 97%
Entrez Gene ID: 6396
Uniprot ID: P55735
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD |
| Gene Sequence | IFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSD |
| Gene ID - Mouse | ENSMUSG00000030298 |
| Gene ID - Rat | ENSRNOG00000010628 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SEC13 pAb (ATL-HPA057943) | |
| Datasheet | Anti SEC13 pAb (ATL-HPA057943) Datasheet (External Link) |
| Vendor Page | Anti SEC13 pAb (ATL-HPA057943) at Atlas Antibodies |
| Documents & Links for Anti SEC13 pAb (ATL-HPA057943) | |
| Datasheet | Anti SEC13 pAb (ATL-HPA057943) Datasheet (External Link) |
| Vendor Page | Anti SEC13 pAb (ATL-HPA057943) |