Anti SDR39U1 pAb (ATL-HPA075356)

Atlas Antibodies

SKU:
ATL-HPA075356-25
  • Immunofluorescent staining of human cell line SH-SY5Y shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: short chain dehydrogenase/reductase family 39U member 1
Gene Name: SDR39U1
Alternative Gene Name: C14orf124, HCDI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022223: 86%, ENSRNOG00000020544: 90%
Entrez Gene ID: 56948
Uniprot ID: Q9NRG7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VNLAGENILNPLRRWNETFQKEVLGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAA
Gene Sequence VNLAGENILNPLRRWNETFQKEVLGSRLETTQLLAKAITKAPQPPKAWVLVTGVAYYQPSLTAEYDEDSPGGDFDFFSNLVTKWEAAA
Gene ID - Mouse ENSMUSG00000022223
Gene ID - Rat ENSRNOG00000020544
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SDR39U1 pAb (ATL-HPA075356)
Datasheet Anti SDR39U1 pAb (ATL-HPA075356) Datasheet (External Link)
Vendor Page Anti SDR39U1 pAb (ATL-HPA075356) at Atlas Antibodies

Documents & Links for Anti SDR39U1 pAb (ATL-HPA075356)
Datasheet Anti SDR39U1 pAb (ATL-HPA075356) Datasheet (External Link)
Vendor Page Anti SDR39U1 pAb (ATL-HPA075356)