Anti SDHD pAb (ATL-HPA045727)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045727-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: SDHD
Alternative Gene Name: cybS, PGL, PGL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000171: 78%, ENSRNOG00000022980: 76%
Entrez Gene ID: 6392
Uniprot ID: O14521
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW |
Gene Sequence | RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW |
Gene ID - Mouse | ENSMUSG00000000171 |
Gene ID - Rat | ENSRNOG00000022980 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SDHD pAb (ATL-HPA045727) | |
Datasheet | Anti SDHD pAb (ATL-HPA045727) Datasheet (External Link) |
Vendor Page | Anti SDHD pAb (ATL-HPA045727) at Atlas Antibodies |
Documents & Links for Anti SDHD pAb (ATL-HPA045727) | |
Datasheet | Anti SDHD pAb (ATL-HPA045727) Datasheet (External Link) |
Vendor Page | Anti SDHD pAb (ATL-HPA045727) |