Anti SDHD pAb (ATL-HPA045727)

Atlas Antibodies

Catalog No.: ATL-HPA045727-25

Protein Description: succinate dehydrogenase complex subunit D
Gene Name: SDHD
Alternative Gene Name: cybS, PGL, PGL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000171: 78%, ENSRNOG00000022980: 76%
Entrez Gene ID: 6392
Uniprot ID: O14521
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW
• Gene Sequence: RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW
• Gene ID - Mouse: ENSMUSG00000000171
• Gene ID - Rat: ENSRNOG00000022980
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.