Anti SDHB pAb (ATL-HPA002868 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA002868-25

Protein Description: succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Gene Name: SDHB
Alternative Gene Name: SDH, SDH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009863: 97%, ENSRNOG00000007967: 97%
Entrez Gene ID: 6390
Uniprot ID: P21912
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
• Gene Sequence: EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
• Gene ID - Mouse: ENSMUSG00000009863
• Gene ID - Rat: ENSRNOG00000007967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SDHB pAb (ATL-HPA002868 w/enhanced validation) – 32 Found

Cassol, Clarissa A; Winer, Daniel; Liu, Wei; Guo, Miao; Ezzat, Shereen; Asa, Sylvia L. Tyrosine kinase receptors as molecular targets in pheochromocytomas and paragangliomas. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2014;27(8):1050-62. 

Loriot, Céline; Domingues, Mélanie; Berger, Adeline; Menara, Mélanie; Ruel, Maëva; Morin, Aurélie; Castro-Vega, Luis-Jaime; Letouzé, Éric; Martinelli, Cosimo; Bemelmans, Alexis-Pierre; Larue, Lionel; Gimenez-Roqueplo, Anne-Paule; Favier, Judith. Deciphering the molecular basis of invasiveness in Sdhb-deficient cells. Oncotarget. 2015;6(32):32955-65. 

Rhein, Virginie F; Carroll, Joe; Ding, Shujing; Fearnley, Ian M; Walker, John E. NDUFAF5 Hydroxylates NDUFS7 at an Early Stage in the Assembly of Human Complex I. The Journal Of Biological Chemistry. 2016;291(28):14851-60. 

Cleven, Arjen H G; Suijker, Johnny; Agrogiannis, Georgios; Briaire-de Bruijn, Inge H; Frizzell, Norma; Hoekstra, Attje S; Wijers-Koster, Pauline M; Cleton-Jansen, Anne-Marie; Bovée, Judith V M G. IDH1 or -2 mutations do not predict outcome and do not cause loss of 5-hydroxymethylcytosine or altered histone modifications in central chondrosarcomas. Clinical Sarcoma Research. 7( 28484589):8. 

Koh, Jung-Min; Ahn, Seong Hee; Kim, Hyeonmok; Kim, Beom-Jun; Sung, Tae-Yon; Kim, Young Hoon; Hong, Suck Joon; Song, Dong Eun; Lee, Seung Hun. Validation of pathological grading systems for predicting metastatic potential in pheochromocytoma and paraganglioma. Plos One. 12(11):e0187398. 

Richter, Susan; Gieldon, Laura; Pang, Ying; Peitzsch, Mirko; Huynh, Thanh; Leton, Rocio; Viana, Bruna; Ercolino, Tonino; Mangelis, Anastasios; Rapizzi, Elena; Menschikowski, Mario; Aust, Daniela; Kroiss, Matthias; Beuschlein, Felix; Gudziol, Volker; Timmers, Henri Jlm; Lenders, Jacques; Mannelli, Massimo; Cascon, Alberto; Pacak, Karel; Robledo, Mercedes; Eisenhofer, Graeme; Klink, Barbara. Metabolome-guided genomics to identify pathogenic variants in isocitrate dehydrogenase, fumarate hydratase, and succinate dehydrogenase genes in pheochromocytoma and paraganglioma. Genetics In Medicine : Official Journal Of The American College Of Medical Genetics. 2019;21(3):705-717. 

Roh, Tae Hoon; Yim, Hyunee; Roh, Jin; Lee, Kyi Beom; Park, So Hyun; Jeong, Seon-Yong; Kim, Se-Hyuk; Kim, Jang-Hee. The loss of succinate dehydrogenase B expression is frequently identified in hemangioblastoma of the central nervous system. Scientific Reports. 2019;9(1):5873. 

Hoel, August; Osman, Tarig; Hoel, Fredrik; Elsaid, Hassan; Chen, Tony; Landolt, Lea; Babickova, Janka; Tronstad, Karl Johan; Lorens, James B; Gausdal, Gro; Marti, Hans-Peter; Furriol, Jessica. Axl-inhibitor bemcentinib alleviates mitochondrial dysfunction in the unilateral ureter obstruction murine model. Journal Of Cellular And Molecular Medicine. 2021;25(15):7407-7417. 

Quiros-Gonzalez, Isabel; Gonzalez-Menendez, Pedro; Mayo, Juan C; Hevia, David; Artime-Naveda, Francisco; Fernandez-Vega, Sheila; Fernandez-Fernandez, Mario; Rodriguez-Gonzalez, Pablo; Garcia-Alonso, José I; Sainz, Rosa M. Androgen-Dependent Prostate Cancer Cells Reprogram Their Metabolic Signature upon GLUT1 Upregulation by Manganese Superoxide Dismutase. Antioxidants (Basel, Switzerland). 2022;11(2) 

van Nederveen, Francien H; Gaal, José; Favier, Judith; Korpershoek, Esther; Oldenburg, Rogier A; de Bruyn, Elly M C A; Sleddens, Hein F B M; Derkx, Pieter; Rivière, Julie; Dannenberg, Hilde; Petri, Bart-Jeroen; Komminoth, Paul; Pacak, Karel; Hop, Wim C J; Pollard, Patrick J; Mannelli, Massimo; Bayley, Jean-Pierre; Perren, Aurel; Niemann, Stephan; Verhofstad, Albert A; de Bruïne, Adriaan P; Maher, Eamonn R; Tissier, Frédérique; Méatchi, Tchao; Badoual, Cécile; Bertherat, Jérôme; Amar, Laurence; Alataki, Despoina; Van Marck, Eric; Ferrau, Francesco; François, Jerney; de Herder, Wouter W; Peeters, Mark-Paul F M Vrancken; van Linge, Anne; Lenders, Jacques W M; Gimenez-Roqueplo, Anne-Paule; de Krijger, Ronald R; Dinjens, Winand N M. An immunohistochemical procedure to detect patients with paraganglioma and phaeochromocytoma with germline SDHB, SDHC, or SDHD gene mutations: a retrospective and prospective analysis. The Lancet. Oncology. 2009;10(8):764-71. 

Favier, Judith; Brière, Jean-Jacques; Burnichon, Nelly; Rivière, Julie; Vescovo, Laure; Benit, Paule; Giscos-Douriez, Isabelle; De Reyniès, Aurélien; Bertherat, Jérôme; Badoual, Cécile; Tissier, Frédérique; Amar, Laurence; Libé, Rosella; Plouin, Pierre-François; Jeunemaitre, Xavier; Rustin, Pierre; Gimenez-Roqueplo, Anne-Paule. The Warburg effect is genetically determined in inherited pheochromocytomas. Plos One. 2009;4(9):e7094. 

Burnichon, Nelly; Brière, Jean-Jacques; Libé, Rossella; Vescovo, Laure; Rivière, Julie; Tissier, Frédérique; Jouanno, Elodie; Jeunemaitre, Xavier; Bénit, Paule; Tzagoloff, Alexander; Rustin, Pierre; Bertherat, Jérôme; Favier, Judith; Gimenez-Roqueplo, Anne-Paule. SDHA is a tumor suppressor gene causing paraganglioma. Human Molecular Genetics. 2010;19(15):3011-20. 

Alataki, Despoina; Triantafyllidis, A; Gaal, José; Rodiou, C; Vouros, J; Papathanasiou, A; Papanicolaou, A; Rombis, V; de Krijger, Ronald R. A non-catecholamine-producing sympathetic paraganglioma of the spermatic cord: the importance of performing candidate gene mutation analysis. Virchows Archiv : An International Journal Of Pathology. 2010;457(5):619-22. 

Gaal, José; Stratakis, Constantine A; Carney, J Aidan; Ball, Evan R; Korpershoek, Esther; Lodish, Maya B; Levy, Isaac; Xekouki, Paraskevi; van Nederveen, Francien H; den Bakker, Michael A; O'Sullivan, Maureen; Dinjens, Winand N M; de Krijger, Ronald R. SDHB immunohistochemistry: a useful tool in the diagnosis of Carney-Stratakis and Carney triad gastrointestinal stromal tumors. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2011;24(1):147-51. 

Marchiani, S; Tamburrino, L; Giuliano, L; Nosi, D; Sarli, V; Gandini, L; Piomboni, P; Belmonte, G; Forti, G; Baldi, E; Muratori, M. Sumo1-ylation of human spermatozoa and its relationship with semen quality. International Journal Of Andrology. 2011;34(6 Pt 1):581-93. 

Xekouki, Paraskevi; Pacak, Karel; Almeida, Madson; Wassif, Christopher A; Rustin, Pierre; Nesterova, Maria; de la Luz Sierra, Maria; Matro, Joey; Ball, Evan; Azevedo, Monalisa; Horvath, Anelia; Lyssikatos, Charalampos; Quezado, Martha; Patronas, Nicholas; Ferrando, Barbara; Pasini, Barbara; Lytras, Aristides; Tolis, George; Stratakis, Constantine A. Succinate dehydrogenase (SDH) D subunit (SDHD) inactivation in a growth-hormone-producing pituitary tumor: a new association for SDH?. The Journal Of Clinical Endocrinology And Metabolism. 2012;97(3):E357-66. 

Rapizzi, E; Ercolino, T; Canu, L; Giaché, V; Francalanci, M; Pratesi, C; Valeri, A; Mannelli, M. Mitochondrial function and content in pheochromocytoma/paraganglioma of succinate dehydrogenase mutation carriers. Endocrine-Related Cancer. 2012;19(3):261-9. 

Pantaleo, Maria A; Astolfi, Annalisa; Urbini, Milena; Nannini, Margherita; Paterini, Paola; Indio, Valentina; Saponara, Maristella; Formica, Serena; Ceccarelli, Claudio; Casadio, Rita; Rossi, Giulio; Bertolini, Federica; Santini, Donatella; Pirini, Maria G; Fiorentino, Michelangelo; Basso, Umberto; Biasco, Guido. Analysis of all subunits, SDHA, SDHB, SDHC, SDHD, of the succinate dehydrogenase complex in KIT/PDGFRA wild-type GIST. European Journal Of Human Genetics : Ejhg. 2014;22(1):32-9. 

Jamilloux, Yvan; Favier, Judith; Pertuit, Morgane; Delage-Corre, Manuela; Lopez, Stéphanie; Teissier, Marie-Pierre; Mathonnet, Muriel; Galinat, Sophie; Barlier, Anne; Archambeaud, Françoise. A MEN1 syndrome with a paraganglioma. European Journal Of Human Genetics : Ejhg. 2014;22(2):283-5. 

Haller, Florian; Moskalev, Evgeny A; Faucz, Fabio R; Barthelmeß, Sarah; Wiemann, Stefan; Bieg, Matthias; Assie, Guillaume; Bertherat, Jerome; Schaefer, Inga-Marie; Otto, Claudia; Rattenberry, Eleanor; Maher, Eamonn R; Ströbel, Philipp; Werner, Martin; Carney, J Aidan; Hartmann, Arndt; Stratakis, Constantine A; Agaimy, Abbas. Aberrant DNA hypermethylation of SDHC: a novel mechanism of tumor development in Carney triad. Endocrine-Related Cancer. 2014;21(4):567-77. 

Nannini, Margherita; Astolfi, Annalisa; Urbini, Milena; Indio, Valentina; Santini, Donatella; Heinrich, Michael C; Corless, Christopher L; Ceccarelli, Claudio; Saponara, Maristella; Mandrioli, Anna; Lolli, Cristian; Ercolani, Giorgio; Brandi, Giovanni; Biasco, Guido; Pantaleo, Maria A. Integrated genomic study of quadruple-WT GIST (KIT/PDGFRA/SDH/RAS pathway wild-type GIST). Bmc Cancer. 2014;14( 25239601):685. 

Bayley, Jean-Pierre; Oldenburg, Rogier A; Nuk, Jennifer; Hoekstra, Attje S; van der Meer, Conny A; Korpershoek, Esther; McGillivray, Barbara; Corssmit, Eleonora P M; Dinjens, Winand N M; de Krijger, Ronald R; Devilee, Peter; Jansen, Jeroen C; Hes, Frederik J. Paraganglioma and pheochromocytoma upon maternal transmission of SDHD mutations. Bmc Medical Genetics. 2014;15( 25300370):111. 

Desmurs, Marjorie; Foti, Michelangelo; Raemy, Etienne; Vaz, Frédéric Maxime; Martinou, Jean-Claude; Bairoch, Amos; Lane, Lydie. C11orf83, a mitochondrial cardiolipin-binding protein involved in bc1 complex assembly and supercomplex stabilization. Molecular And Cellular Biology. 2015;35(7):1139-56. 

Giubellino, Alessio; Lara, Karlena; Martucci, Victoria; Huynh, Than; Agarwal, Piyush; Pacak, Karel; Merino, Maria J. Urinary Bladder Paragangliomas: How Immunohistochemistry Can Assist to Identify Patients With SDHB Germline and Somatic Mutations. The American Journal Of Surgical Pathology. 2015;39(11):1488-92. 

Bullova, Petra; Cougnoux, Antony; Abunimer, Luma; Kopacek, Juraj; Pastorekova, Silvia; Pacak, Karel. Hypoxia potentiates the cytotoxic effect of piperlongumine in pheochromocytoma models. Oncotarget. 2016;7(26):40531-40545. 

Louphrasitthiphol, Pakavarin; Ledaki, Ioanna; Chauhan, Jagat; Falletta, Paola; Siddaway, Robert; Buffa, Francesca M; Mole, David R; Soga, Tomoyoshi; Goding, Colin R. MITF controls the TCA cycle to modulate the melanoma hypoxia response. Pigment Cell & Melanoma Research. 2019;32(6):792-808. 

Ni, Yang; Hagras, Muhammad A; Konstantopoulou, Vassiliki; Mayr, Johannes A; Stuchebrukhov, Alexei A; Meierhofer, David. Mutations in NDUFS1 Cause Metabolic Reprogramming and Disruption of the Electron Transfer. Cells. 2019;8(10) 

Agarwal, Gaurav; Rajan, Sendhil; Valiveru, Ramya C; Tulsyan, Sonam; Agrawal, Vinita; Mittal, Balraj; Zaidi, Ghazala; Mayilvaganan, Sabaretnam; Mishra, Anjali; Agarwal, Amit; Mishra, Saroj Kanta; Bhatia, Eesh. Genetic Profile of Indian Pheochromocytoma and Paraganglioma Patients - A Single Institutional Study. Indian Journal Of Endocrinology And Metabolism. 2019;23(4):486-490. 

Wallace, Paal W; Conrad, Catleen; Brückmann, Sascha; Pang, Ying; Caleiras, Eduardo; Murakami, Masanori; Korpershoek, Esther; Zhuang, Zhengping; Rapizzi, Elena; Kroiss, Matthias; Gudziol, Volker; Timmers, Henri Jlm; Mannelli, Massimo; Pietzsch, Jens; Beuschlein, Felix; Pacak, Karel; Robledo, Mercedes; Klink, Barbara; Peitzsch, Mirko; Gill, Anthony J; Tischler, Arthur S; de Krijger, Ronald R; Papathomas, Thomas; Aust, Daniela; Eisenhofer, Graeme; Richter, Susan. Metabolomics, machine learning and immunohistochemistry to predict succinate dehydrogenase mutational status in phaeochromocytomas and paragangliomas. The Journal Of Pathology. 2020;251(4):378-387. 

Whitworth, James; Casey, Ruth T; Smith, Philip S; Giger, Olivier; Martin, Jose Ezequiel; Clark, Graeme; Cook, Jaqueline; Fernando, Marlee S; Taniere, Phillipe; Maher, Eamonn R. Familial wild-type gastrointestinal stromal tumour in association with germline truncating variants in both SDHA and PALB2. European Journal Of Human Genetics : Ejhg. 2021;29(7):1139-1145. 

De Leo, A; Vara, G; Paccapelo, A; Balacchi, C; Vicennati, V; Tucci, L; Pagotto, U; Selva, S; Ricci, C; Alberici, L; Minni, F; Nanni, C; Ambrosi, F; Santini, D; Golfieri, R; Di Dalmazi, G; Mosconi, C. Computerized tomography texture analysis of pheochromocytoma: relationship with hormonal and histopathological data. Journal Of Endocrinological Investigation. 2022;45(10):1935-1944. 

Mandelker, Diana; Marra, Antonio; Mehta, Nikita; Selenica, Pier; Yelskaya, Zarina; Yang, Ciyu; Somar, Joshua; Mehine, Miika; Misyura, Maksym; Basturk, Olca; Latham, Alicia; Carlo, Maria; Walsh, Michael; Stadler, Zsofia K; Offit, Kenneth; Bandlamudi, Chaitanya; Hameed, Meera; Chi, Ping; Reis-Filho, Jorge S; Ceyhan-Birsoy, Ozge. Expanded genetic testing of GIST patients identifies high proportion of non-syndromic patients with germline alterations. Npj Precision Oncology. 2023;7(1):1.