Anti SDC4 pAb (ATL-HPA005716 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA005716-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: SDC4
Alternative Gene Name: amphiglycan, ryudocan, SYND4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017009: 75%, ENSRNOG00000014297: 75%
Entrez Gene ID: 6385
Uniprot ID: P31431
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEV |
Gene Sequence | PQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEV |
Gene ID - Mouse | ENSMUSG00000017009 |
Gene ID - Rat | ENSRNOG00000014297 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti SDC4 pAb (ATL-HPA005716 w/enhanced validation) | |
Datasheet | Anti SDC4 pAb (ATL-HPA005716 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SDC4 pAb (ATL-HPA005716 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti SDC4 pAb (ATL-HPA005716 w/enhanced validation) | |
Datasheet | Anti SDC4 pAb (ATL-HPA005716 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti SDC4 pAb (ATL-HPA005716 w/enhanced validation) |
Citations for Anti SDC4 pAb (ATL-HPA005716 w/enhanced validation) – 2 Found |
Jeyarajah, Mariyan J; Jaju Bhattad, Gargi; Kops, Brianna F; Renaud, Stephen J. Syndecan-4 regulates extravillous trophoblast migration by coordinating protein kinase C activation. Scientific Reports. 2019;9(1):10175. PubMed |
Bang-Christensen, Sara R; Pedersen, Rasmus S; Pereira, Marina A; Clausen, Thomas M; Løppke, Caroline; Sand, Nicolai T; Ahrens, Theresa D; Jørgensen, Amalie M; Lim, Yi Chieh; Goksøyr, Louise; Choudhary, Swati; Gustavsson, Tobias; Dagil, Robert; Daugaard, Mads; Sander, Adam F; Torp, Mathias H; Søgaard, Max; Theander, Thor G; Østrup, Olga; Lassen, Ulrik; Hamerlik, Petra; Salanti, Ali; Agerbæk, Mette Ø. Capture and Detection of Circulating Glioma Cells Using the Recombinant VAR2CSA Malaria Protein. Cells. 2019;8(9) PubMed |