Anti SCYL1 pAb (ATL-HPA015015)

Atlas Antibodies

Catalog No.: ATL-HPA015015-25

Protein Description: SCY1-like 1 (S. cerevisiae)
Gene Name: SCYL1
Alternative Gene Name: GKLP, HT019, MGC78454, NKTL, NTKL, P105, TAPK, TEIF, TRAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024941: 96%, ENSRNOG00000023668: 95%
Entrez Gene ID: 57410
Uniprot ID: Q96KG9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMK
• Gene Sequence: AFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMK
• Gene ID - Mouse: ENSMUSG00000024941
• Gene ID - Rat: ENSRNOG00000023668
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCYL1 pAb (ATL-HPA015015) – 3 Found

Gingras, Sebastien; Kuliyev, Emin; Pelletier, Stéphane. SCYL1 does not regulate REST expression and turnover. Plos One. 12(6):e0178680. 

Amano, Genki; Matsuzaki, Shinsuke; Mori, Yasutake; Miyoshi, Ko; Han, Sarina; Shikada, Sho; Takamura, Hironori; Yoshimura, Takeshi; Katayama, Taiichi. SCYL1 arginine methylation by PRMT1 is essential for neurite outgrowth via Golgi morphogenesis. Molecular Biology Of The Cell. 2020;31(18):1963-1973. 

Kaeser-Pebernard, Stéphanie; Vionnet, Christine; Mari, Muriel; Sankar, Devanarayanan Siva; Hu, Zehan; Roubaty, Carole; Martínez-Martínez, Esther; Zhao, Huiyuan; Spuch-Calvar, Miguel; Petri-Fink, Alke; Rainer, Gregor; Steinberg, Florian; Reggiori, Fulvio; Dengjel, Jörn. mTORC1 controls Golgi architecture and vesicle secretion by phosphorylation of SCYL1. Nature Communications. 2022;13(1):4685.