Anti SCUBE3 pAb (ATL-HPA040606)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040606-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SCUBE3
Alternative Gene Name: CEGF3, FLJ34743
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038677: 89%, ENSRNOG00000000500: 90%
Entrez Gene ID: 222663
Uniprot ID: Q8IX30
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLSIKQRASFKIKDAKCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRAEETTAS |
| Gene Sequence | VLSIKQRASFKIKDAKCRLHLRNKGKTEEAGRITGPGGAPCSECQVTFIHLKCDSSRKGKGRRARTPPGKEVTRLTLELEAEVRAEETTAS |
| Gene ID - Mouse | ENSMUSG00000038677 |
| Gene ID - Rat | ENSRNOG00000000500 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SCUBE3 pAb (ATL-HPA040606) | |
| Datasheet | Anti SCUBE3 pAb (ATL-HPA040606) Datasheet (External Link) |
| Vendor Page | Anti SCUBE3 pAb (ATL-HPA040606) at Atlas Antibodies |
| Documents & Links for Anti SCUBE3 pAb (ATL-HPA040606) | |
| Datasheet | Anti SCUBE3 pAb (ATL-HPA040606) Datasheet (External Link) |
| Vendor Page | Anti SCUBE3 pAb (ATL-HPA040606) |