Anti SCRT2 pAb (ATL-HPA067697)
Atlas Antibodies
- Catalog No.:
- ATL-HPA067697-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: SCRT2
Alternative Gene Name: ZNF898B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060257: 97%, ENSRNOG00000005148: 97%
Entrez Gene ID: 85508
Uniprot ID: Q9NQ03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | APEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAF |
| Gene Sequence | APEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAF |
| Gene ID - Mouse | ENSMUSG00000060257 |
| Gene ID - Rat | ENSRNOG00000005148 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SCRT2 pAb (ATL-HPA067697) | |
| Datasheet | Anti SCRT2 pAb (ATL-HPA067697) Datasheet (External Link) |
| Vendor Page | Anti SCRT2 pAb (ATL-HPA067697) at Atlas Antibodies |
| Documents & Links for Anti SCRT2 pAb (ATL-HPA067697) | |
| Datasheet | Anti SCRT2 pAb (ATL-HPA067697) Datasheet (External Link) |
| Vendor Page | Anti SCRT2 pAb (ATL-HPA067697) |