Anti SCRT2 pAb (ATL-HPA067697)

Atlas Antibodies

Catalog No.:
ATL-HPA067697-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: scratch family zinc finger 2
Gene Name: SCRT2
Alternative Gene Name: ZNF898B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060257: 97%, ENSRNOG00000005148: 97%
Entrez Gene ID: 85508
Uniprot ID: Q9NQ03
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen APEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAF
Gene Sequence APEEYSDPESPQSSLSARYFRGEAAVTDSYSMDAF
Gene ID - Mouse ENSMUSG00000060257
Gene ID - Rat ENSRNOG00000005148
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCRT2 pAb (ATL-HPA067697)
Datasheet Anti SCRT2 pAb (ATL-HPA067697) Datasheet (External Link)
Vendor Page Anti SCRT2 pAb (ATL-HPA067697) at Atlas Antibodies

Documents & Links for Anti SCRT2 pAb (ATL-HPA067697)
Datasheet Anti SCRT2 pAb (ATL-HPA067697) Datasheet (External Link)
Vendor Page Anti SCRT2 pAb (ATL-HPA067697)