Anti SCRN3 pAb (ATL-HPA034690)

Atlas Antibodies

Catalog No.:
ATL-HPA034690-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: secernin 3
Gene Name: SCRN3
Alternative Gene Name: FLJ23142
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000008226: 84%, ENSRNOG00000018657: 84%
Entrez Gene ID: 79634
Uniprot ID: Q0VDG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DMRNYAKRKGWWDGKKEFDFAAAYSYLDTAKMMTSSGRYCEGYKLLNKHKGNITFETMMEILRDKPSGINMEGEFLTTA
Gene Sequence DMRNYAKRKGWWDGKKEFDFAAAYSYLDTAKMMTSSGRYCEGYKLLNKHKGNITFETMMEILRDKPSGINMEGEFLTTA
Gene ID - Mouse ENSMUSG00000008226
Gene ID - Rat ENSRNOG00000018657
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCRN3 pAb (ATL-HPA034690)
Datasheet Anti SCRN3 pAb (ATL-HPA034690) Datasheet (External Link)
Vendor Page Anti SCRN3 pAb (ATL-HPA034690) at Atlas Antibodies

Documents & Links for Anti SCRN3 pAb (ATL-HPA034690)
Datasheet Anti SCRN3 pAb (ATL-HPA034690) Datasheet (External Link)
Vendor Page Anti SCRN3 pAb (ATL-HPA034690)