Anti SCRN2 pAb (ATL-HPA022934 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA022934-25

Protein Description: secernin 2
Gene Name: SCRN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020877: 83%, ENSRNOG00000010214: 80%
Entrez Gene ID: 90507
Uniprot ID: Q96FV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSIGTDISAQHPELRTHAQAKGWWDGQGAFDFAQIFSLTQQPVRMEAAKARFQAGRELLRQRQGGITAEVMMGILRDKESGICMDS
• Gene Sequence: LSIGTDISAQHPELRTHAQAKGWWDGQGAFDFAQIFSLTQQPVRMEAAKARFQAGRELLRQRQGGITAEVMMGILRDKESGICMDS
• Gene ID - Mouse: ENSMUSG00000020877
• Gene ID - Rat: ENSRNOG00000010214
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.