Anti SCPEP1 pAb (ATL-HPA057200)

Atlas Antibodies

Catalog No.:
ATL-HPA057200-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: serine carboxypeptidase 1
Gene Name: SCPEP1
Alternative Gene Name: RISC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000278: 85%, ENSRNOG00000002358: 86%
Entrez Gene ID: 59342
Uniprot ID: Q9HB40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTGFSYVNGSGAYAKDLAMVASDMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKC
Gene Sequence GTGFSYVNGSGAYAKDLAMVASDMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLELYKAIQRGTIKC
Gene ID - Mouse ENSMUSG00000000278
Gene ID - Rat ENSRNOG00000002358
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCPEP1 pAb (ATL-HPA057200)
Datasheet Anti SCPEP1 pAb (ATL-HPA057200) Datasheet (External Link)
Vendor Page Anti SCPEP1 pAb (ATL-HPA057200) at Atlas Antibodies

Documents & Links for Anti SCPEP1 pAb (ATL-HPA057200)
Datasheet Anti SCPEP1 pAb (ATL-HPA057200) Datasheet (External Link)
Vendor Page Anti SCPEP1 pAb (ATL-HPA057200)