Anti SCO1 pAb (ATL-HPA021579 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA021579-25

Protein Description: SCO1 cytochrome c oxidase assembly protein
Gene Name: SCO1
Alternative Gene Name: SCOD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069844: 87%, ENSRNOG00000028699: 87%
Entrez Gene ID: 6341
Uniprot ID: O75880
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTG
• Gene Sequence: CPDVCPEELEKMIQVVDEIDSITTLPDLTPLFISIDPERDTKEAIANYVKEFSPKLVGLTG
• Gene ID - Mouse: ENSMUSG00000069844
• Gene ID - Rat: ENSRNOG00000028699
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti SCO1 pAb (ATL-HPA021579 w/enhanced validation) – 1 Found

Bruhn, Christopher; Bastianello, Giulia; Foiani, Marco. Cancer cell histone density links global histone acetylation, mitochondrial proteome and histone acetylase inhibitor sensitivity. Communications Biology. 2022;5(1):882.