Anti SCNN1A pAb (ATL-HPA012743 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012743-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: SCNN1A
Alternative Gene Name: ENaCalpha, SCNN1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030340: 78%, ENSRNOG00000019368: 76%
Entrez Gene ID: 6337
Uniprot ID: P37088
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQL |
| Gene Sequence | RYPEIKEELEELDRITEQTLFDLYKYSSFTTLVAGSRSRRDLRGTLPHPLQRLRVPPPPHGARRARSVASSLRDNNPQVDWKDWKIGFQL |
| Gene ID - Mouse | ENSMUSG00000030340 |
| Gene ID - Rat | ENSRNOG00000019368 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SCNN1A pAb (ATL-HPA012743 w/enhanced validation) | |
| Datasheet | Anti SCNN1A pAb (ATL-HPA012743 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SCNN1A pAb (ATL-HPA012743 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti SCNN1A pAb (ATL-HPA012743 w/enhanced validation) | |
| Datasheet | Anti SCNN1A pAb (ATL-HPA012743 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti SCNN1A pAb (ATL-HPA012743 w/enhanced validation) |
| Citations for Anti SCNN1A pAb (ATL-HPA012743 w/enhanced validation) – 3 Found |
| Xu, Peng; Sudarikova, Anastasia V; Ilatovskaya, Daria V; Gildea, John J; Akhter, Mahabuba; Carey, Robert M; Yue, Wei; Jose, Pedro A; Felder, Robin A. Epithelial Sodium Channel Alpha Subunit (αENaC) Is Associated with Inverse Salt Sensitivity of Blood Pressure. Biomedicines. 2022;10(5) PubMed |
| Lou, Jiayan; Wei, Lingjia; Wang, He. SCNN1A Overexpression Correlates with Poor Prognosis and Immune Infiltrates in Ovarian Cancer. International Journal Of General Medicine. 15( 35221714):1743-1763. PubMed |
| Guidone, Daniela; Buccirossi, Martina; Scudieri, Paolo; Genovese, Michele; Sarnataro, Sergio; De Cegli, Rossella; Cresta, Federico; Terlizzi, Vito; Planelles, Gabrielle; Crambert, Gilles; Sermet, Isabelle; Galietta, Luis Jv. Airway surface hyperviscosity and defective mucociliary transport by IL-17/TNF-α are corrected by β-adrenergic stimulus. Jci Insight. 2022;7(22) PubMed |