Anti SCNM1 pAb (ATL-HPA052439)

Atlas Antibodies

Catalog No.:
ATL-HPA052439-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sodium channel modifier 1
Gene Name: SCNM1
Alternative Gene Name: MGC3180
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092607: 100%, ENSRNOG00000021092: 100%
Entrez Gene ID: 79005
Uniprot ID: Q9BWG6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSS
Gene Sequence MSFKREGDDWSQLNVLKKRRVGDLLASYIPEDEALMLRDGRFACAICPHRPVLDTLAMLTAHRAGKKHLSS
Gene ID - Mouse ENSMUSG00000092607
Gene ID - Rat ENSRNOG00000021092
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCNM1 pAb (ATL-HPA052439)
Datasheet Anti SCNM1 pAb (ATL-HPA052439) Datasheet (External Link)
Vendor Page Anti SCNM1 pAb (ATL-HPA052439) at Atlas Antibodies

Documents & Links for Anti SCNM1 pAb (ATL-HPA052439)
Datasheet Anti SCNM1 pAb (ATL-HPA052439) Datasheet (External Link)
Vendor Page Anti SCNM1 pAb (ATL-HPA052439)