Anti SCN8A pAb (ATL-HPA073590)

Atlas Antibodies

Catalog No.:
ATL-HPA073590-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sodium voltage-gated channel alpha subunit 8
Gene Name: SCN8A
Alternative Gene Name: CerIII, CIAT, MED, NaCh6, Nav1.6, PN4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023033: 96%, ENSRNOG00000005309: 93%
Entrez Gene ID: 6334
Uniprot ID: Q9UQD0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSV
Gene Sequence QEEVSAVVLQRAYRGHLARRGFICKKTTSNKLENGGTHREKKESTPSTASLPSYDSV
Gene ID - Mouse ENSMUSG00000023033
Gene ID - Rat ENSRNOG00000005309
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCN8A pAb (ATL-HPA073590)
Datasheet Anti SCN8A pAb (ATL-HPA073590) Datasheet (External Link)
Vendor Page Anti SCN8A pAb (ATL-HPA073590) at Atlas Antibodies

Documents & Links for Anti SCN8A pAb (ATL-HPA073590)
Datasheet Anti SCN8A pAb (ATL-HPA073590) Datasheet (External Link)
Vendor Page Anti SCN8A pAb (ATL-HPA073590)