Anti SCN7A pAb (ATL-HPA072715)

Atlas Antibodies

SKU:
ATL-HPA072715-25
  • Immunohistochemical staining of human heart muscle shows strong cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sodium voltage-gated channel alpha subunit 7
Gene Name: SCN7A
Alternative Gene Name: NaG, Nav2.1, Nav2.2, SCN6A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034810: 58%, ENSRNOG00000029342: 46%
Entrez Gene ID: 6332
Uniprot ID: Q01118
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY
Gene Sequence LAMAYEEEKQRVGEISKKIEPKFQQTGKELQEGNETDEAKTIQIEMKKRSPISTDTSLDVLEDATLRHKEELEKSKKICPLYWY
Gene ID - Mouse ENSMUSG00000034810
Gene ID - Rat ENSRNOG00000029342
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti SCN7A pAb (ATL-HPA072715)
Datasheet Anti SCN7A pAb (ATL-HPA072715) Datasheet (External Link)
Vendor Page Anti SCN7A pAb (ATL-HPA072715) at Atlas Antibodies

Documents & Links for Anti SCN7A pAb (ATL-HPA072715)
Datasheet Anti SCN7A pAb (ATL-HPA072715) Datasheet (External Link)
Vendor Page Anti SCN7A pAb (ATL-HPA072715)