Anti SCN4A pAb (ATL-HPA053992)

Atlas Antibodies

Catalog No.:
ATL-HPA053992-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: sodium channel, voltage-gated, type IV, alpha subunit
Gene Name: SCN4A
Alternative Gene Name: HYKPP, HYPP, Nav1.4, SkM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001027: 65%, ENSRNOG00000012134: 67%
Entrez Gene ID: 6329
Uniprot ID: P35499
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMYGHENGNSSSPSPEEKGE
Gene Sequence MKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMYGHENGNSSSPSPEEKGE
Gene ID - Mouse ENSMUSG00000001027
Gene ID - Rat ENSRNOG00000012134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCN4A pAb (ATL-HPA053992)
Datasheet Anti SCN4A pAb (ATL-HPA053992) Datasheet (External Link)
Vendor Page Anti SCN4A pAb (ATL-HPA053992) at Atlas Antibodies

Documents & Links for Anti SCN4A pAb (ATL-HPA053992)
Datasheet Anti SCN4A pAb (ATL-HPA053992) Datasheet (External Link)
Vendor Page Anti SCN4A pAb (ATL-HPA053992)