Anti SCN3B pAb (ATL-HPA041707)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041707-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: SCN3B
Alternative Gene Name: HSA243396
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049281: 100%, ENSRNOG00000057221: 100%
Entrez Gene ID: 55800
Uniprot ID: Q9NY72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFT |
| Gene Sequence | RLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFT |
| Gene ID - Mouse | ENSMUSG00000049281 |
| Gene ID - Rat | ENSRNOG00000057221 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti SCN3B pAb (ATL-HPA041707) | |
| Datasheet | Anti SCN3B pAb (ATL-HPA041707) Datasheet (External Link) |
| Vendor Page | Anti SCN3B pAb (ATL-HPA041707) at Atlas Antibodies |
| Documents & Links for Anti SCN3B pAb (ATL-HPA041707) | |
| Datasheet | Anti SCN3B pAb (ATL-HPA041707) Datasheet (External Link) |
| Vendor Page | Anti SCN3B pAb (ATL-HPA041707) |