Anti SCN3B pAb (ATL-HPA041707)

Atlas Antibodies

Catalog No.:
ATL-HPA041707-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: sodium voltage-gated channel beta subunit 3
Gene Name: SCN3B
Alternative Gene Name: HSA243396
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049281: 100%, ENSRNOG00000057221: 100%
Entrez Gene ID: 55800
Uniprot ID: Q9NY72
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFT
Gene Sequence RLQWNGSKDLQDVSITVLNVTLNDSGLYTCNVSREFEFEAHRPFVKTTRLIPLRVTEEAGEDFT
Gene ID - Mouse ENSMUSG00000049281
Gene ID - Rat ENSRNOG00000057221
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCN3B pAb (ATL-HPA041707)
Datasheet Anti SCN3B pAb (ATL-HPA041707) Datasheet (External Link)
Vendor Page Anti SCN3B pAb (ATL-HPA041707) at Atlas Antibodies

Documents & Links for Anti SCN3B pAb (ATL-HPA041707)
Datasheet Anti SCN3B pAb (ATL-HPA041707) Datasheet (External Link)
Vendor Page Anti SCN3B pAb (ATL-HPA041707)