Anti SCML4 pAb (ATL-HPA063326)
Atlas Antibodies
- Catalog No.:
 - ATL-HPA063326-25
 
- Shipping:
 - Calculated at Checkout
 
        
            
        
        
        $447.00
    
         
                            Gene Name: SCML4
Alternative Gene Name: dJ47M23.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044770: 87%, ENSRNOG00000026110: 90%
Entrez Gene ID: 256380
Uniprot ID: Q8N228
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | KSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERK | 
| Gene Sequence | KSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERK | 
| Gene ID - Mouse | ENSMUSG00000044770 | 
| Gene ID - Rat | ENSRNOG00000026110 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti SCML4 pAb (ATL-HPA063326) | |
| Datasheet | Anti SCML4 pAb (ATL-HPA063326) Datasheet (External Link) | 
| Vendor Page | Anti SCML4 pAb (ATL-HPA063326) at Atlas Antibodies | 
| Documents & Links for Anti SCML4 pAb (ATL-HPA063326) | |
| Datasheet | Anti SCML4 pAb (ATL-HPA063326) Datasheet (External Link) | 
| Vendor Page | Anti SCML4 pAb (ATL-HPA063326) |