Anti SCML4 pAb (ATL-HPA063326)

Atlas Antibodies

Catalog No.:
ATL-HPA063326-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: sex comb on midleg-like 4 (Drosophila)
Gene Name: SCML4
Alternative Gene Name: dJ47M23.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044770: 87%, ENSRNOG00000026110: 90%
Entrez Gene ID: 256380
Uniprot ID: Q8N228
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERK
Gene Sequence KSRVLMTPLALSPPRSTPEPDLSSIPQDAATVPSLAAPQALTVCLYINKQANAGPYLERK
Gene ID - Mouse ENSMUSG00000044770
Gene ID - Rat ENSRNOG00000026110
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti SCML4 pAb (ATL-HPA063326)
Datasheet Anti SCML4 pAb (ATL-HPA063326) Datasheet (External Link)
Vendor Page Anti SCML4 pAb (ATL-HPA063326) at Atlas Antibodies

Documents & Links for Anti SCML4 pAb (ATL-HPA063326)
Datasheet Anti SCML4 pAb (ATL-HPA063326) Datasheet (External Link)
Vendor Page Anti SCML4 pAb (ATL-HPA063326)